PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa13g003860.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family HD-ZIP
Protein Properties Length: 83aa    MW: 9887.13 Da    PI: 9.4376
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa13g003860.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox37.63.7e-1232642456
                    S--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox 24 ypsaeereeLAkklgLterqVkvWFqNrRakek 56
                    +p ae++ +LAk+l+++ rq  vWFqNrRa++k
  Csa13g003860.1 32 NPYAERKLKLAKELDMEPRQEAVWFQNRRARWK 64
                    78999***************************9 PP

2HD-ZIP_I/II67.14e-2235782669
     HD-ZIP_I/II 26 perKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkra 69
                     erK +la+eL+++prq avWFqnrRAR+k k+lE  y++Lk++
  Csa13g003860.1 35 AERKLKLAKELDMEPRQEAVWFQNRRARWKVKHLEDSYDSLKSQ 78
                    58****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003899.3E-4770IPR001356Homeobox domain
PROSITE profilePS5007112.0821866IPR001356Homeobox domain
CDDcd000862.00E-82867No hitNo description
SuperFamilySSF466891.11E-102975IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.1E-123174IPR009057Homeodomain-like
PfamPF000461.4E-93264IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
MTSNVQTKRV DYMPSSWLKS NFSNSLCSFS YNPYAERKLK LAKELDMEPR QEAVWFQNRR  60
ARWKVKHLED SYDSLKSQEY DV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002871059.11e-19predicted protein
SwissprotQ9LZR07e-17ATB51_ARATH; Putative homeobox-leucine zipper protein ATHB-51
TrEMBLD7LWT82e-19D7LWT8_ARALL; Predicted protein
STRINGAl_scaffold_0006_2904e-19(Arabidopsis lyrata)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.14e-18homeobox 51